| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A118K3M4
dbSWEET id: dbswt_214
Accession: A0A118K3M4
Uniprot status: Unreviewed
Organism: Cynara cardunculus
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ campanulids ⇒ Asterales ⇒ Asteraceae ⇒ Carduoideae ⇒ Cardueae ⇒ Carduinae ⇒ Cynara.
Sequence Information back to top
Sequence length: 297
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|A0A118K3M4|A0A118K3M4_CYNCS|Unreviewed|Cynara_cardunculus|297
MTGNLAHLTLAFGLLGNVVSFMVFLAPIPTFYKVYKKGSTEGFQSAPYVVGLFSAMLWIY
YALLKSNVMLLITINSVGCIIETLYICFFLFYAPKKARMESLKLIVLLIVVGFGLIVVLT
QFFAHGVNRGVIVGWICLVFSLCVFVAPLGVLRQVIKTKSVEYMPILLSVALTLSAVMWF
FYGLLLGDFNIAIPNVLGFTFGILQMILYFVYKNKKPVTDEKISNFEAKISEMEEQKLPE
YKNQKITDVVKLETLIHSDILPVAAKLNKNGCDQAGHVAVEPKAASYVPNHTIEVAA
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 2 Model end: 214
Alignment file: A0A118K3M4.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A118K3M4_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.5% favored 4.8% allowed .5% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A118K3M4_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.4% favored 5.9% allowed 2.2% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A118K3M4_occluded.pdb
Procheck score ⇒ Ramachandran plot: 95.2% favored 4.3% allowed .0% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22