Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A118JY17

dbSWEET id: dbswt_152

Accession:   A0A118JY17

Uniprot status:   Unreviewed

Organism:   Cynara cardunculus

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ campanulids ⇒ Asterales ⇒ Asteraceae ⇒ Carduoideae ⇒ Cardueae ⇒ Carduinae ⇒ Cynara.

Sequence Information back to top


Sequence length:   291

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|A0A118JY17|A0A118JY17_CYNCS|Unreviewed|Cynara_cardunculus|291
MEVFNVDHPLVFVFGLLGNIISTGVYFAPLPTFIEICKRKSTMGFQSFPYVVSLLSALLW
LYYAFIKEGDTFLLISINSLGTFIESLYIIIFLLYATPNTKKQTFKGLSATLVFCLVISL
GTLFTLQGETRVLVVGWVCVGISIAVFAAPLTIVFEVVRTQSVEFMPLPLSCFLTLSAMM
WFAYGMSLKDICVTVPNILGFILGVVQMGVYAYYKKVASVSDKKPKDQHMMNILSANSEV
HPVDSGRSSEADDDVVAAAVDDNEENKKEECVLVNVKQQSLDHIQLVICAT

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   4     Model end:   216

Alignment file: A0A118JY17.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A118JY17_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.9% favored    7.5% allowed    .5% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A118JY17_outward.pdb

Procheck score ⇒ Ramachandran plot: 89.8% favored    7.5% allowed    .5% week    2.2% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A118JY17_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.5% favored    7.0% allowed    .5% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur