| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A116MY36
dbSWEET id: dbswt_1538
Accession: A0A116MY36
Uniprot status: Unreviewed
Organism: Streptococcus suis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus.
Sequence Information back to top
Sequence length: 79
Substrate Binding Site: MNMN CVV: 440 CHI: -3.2
Selectivity Filter: GGGG CVV: 192 CHI: -1.6
Fasta sequence:
>tr|A0A116MY36|A0A116MY36_STRSU|Unreviewed|Streptococcus suis|79
MIGFIAACLTTFGFILQVIKVVKTKDTESISLGMYVMSVTGMSLWLIHGIIQGDMALMIA
NSVSVTLAGIILVYKLIYK
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 2 Model end: 77 Inward Open: Template: 4X5M.pdb Model structure: A0A116MY36_inward.pdb Alignment file: A0A116MY36_inw.pir Procheck score ⇒ Ramachandran plot: 95.5% favored 3.0% allowed 1.5% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A116MY36_outward.pdb Alignment file: A0A116MY36_out.pir Procheck score ⇒ Ramachandran plot: 92.4% favored 6.8% allowed .8% week .0% disallowed Occluded: Model structure: A0A116MY36_occluded.pdb Alignment file: A0A116MY36_occ.pir Procheck score ⇒ Ramachandran plot: 97.0% favored 3.0% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA