Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A116MY36

dbSWEET id: dbswt_1538

Accession:   A0A116MY36

Uniprot status:   Unreviewed

Organism:   Streptococcus suis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus.

Sequence Information back to top


Sequence length:   79

Substrate Binding Site:   MNMN           CVV:   440       CHI:   -3.2

Selectivity Filter:   GGGG           CVV:   192       CHI:   -1.6

Fasta sequence:

>tr|A0A116MY36|A0A116MY36_STRSU|Unreviewed|Streptococcus suis|79
MIGFIAACLTTFGFILQVIKVVKTKDTESISLGMYVMSVTGMSLWLIHGIIQGDMALMIA
NSVSVTLAGIILVYKLIYK

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   77

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A116MY36_inward.pdb    Alignment file: A0A116MY36_inw.pir

Procheck score ⇒ Ramachandran plot: 95.5% favored    3.0% allowed    1.5% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A116MY36_outward.pdb    Alignment file: A0A116MY36_out.pir

Procheck score ⇒ Ramachandran plot: 92.4% favored    6.8% allowed    .8% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A116MY36_occluded.pdb    Alignment file: A0A116MY36_occ.pir

Procheck score ⇒ Ramachandran plot: 97.0% favored    3.0% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur