Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A109DFY0

dbSWEET id: dbswt_1537

Accession:   A0A109DFY0

Uniprot status:   Unreviewed

Organism:   Lactobacillus crispatus

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.

Sequence Information back to top


Sequence length:   87

Substrate Binding Site:   SNSN           CVV:   338       CHI:   -8.6

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|A0A109DFY0|A0A109DFY0_9LACO|Unreviewed|Lactobacillus crispatus|87
MKNQKAFLIVGRIASIMSVLMYVSYLAQITSNLQGHKGNPLQPFVAALNSTLWVLYGWMN
PVKRDWPIIIANIPGIFLGFLAGITSL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   11     Model end:   88

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A109DFY0_inward.pdb    Alignment file: A0A109DFY0_inw.pir

Procheck score ⇒ Ramachandran plot: 90.6% favored    7.8% allowed    1.6% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A109DFY0_outward.pdb    Alignment file: A0A109DFY0_out.pir

Procheck score ⇒ Ramachandran plot: 93.8% favored    5.5% allowed    .8% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A109DFY0_occluded.pdb    Alignment file: A0A109DFY0_occ.pir

Procheck score ⇒ Ramachandran plot: 92.2% favored    5.5% allowed    1.6% week    .8% disallowed

Gene Informationback to top


Gene ID:   9106661

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur