| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A109DFY0
dbSWEET id: dbswt_1537
Accession: A0A109DFY0
Uniprot status: Unreviewed
Organism: Lactobacillus crispatus
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: SNSN CVV: 338 CHI: -8.6
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A109DFY0|A0A109DFY0_9LACO|Unreviewed|Lactobacillus crispatus|87
MKNQKAFLIVGRIASIMSVLMYVSYLAQITSNLQGHKGNPLQPFVAALNSTLWVLYGWMN
PVKRDWPIIIANIPGIFLGFLAGITSL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 11 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: A0A109DFY0_inward.pdb Alignment file: A0A109DFY0_inw.pir Procheck score ⇒ Ramachandran plot: 90.6% favored 7.8% allowed 1.6% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A109DFY0_outward.pdb Alignment file: A0A109DFY0_out.pir Procheck score ⇒ Ramachandran plot: 93.8% favored 5.5% allowed .8% week .0% disallowed Occluded: Model structure: A0A109DFY0_occluded.pdb Alignment file: A0A109DFY0_occ.pir Procheck score ⇒ Ramachandran plot: 92.2% favored 5.5% allowed 1.6% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA