Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A109DDE4
dbSWEET id: dbswt_1536
Accession: A0A109DDE4
Uniprot status: Unreviewed
Organism: Lactobacillus crispatus
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 92
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A109DDE4|A0A109DDE4_9LACO|Unreviewed|Lactobacillus crispatus|92
MKKFKGLDRKTVLTIGRIGSVLSVLMYVSYIPQIINNLNGNYGNPVQPLVAAINCTIWVL
YAVLGEKKDWPLFTANFPGIIFGLITFFTSLH
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 16 Model end: 92 Inward Open: Template: 4X5M.pdb Model structure: A0A109DDE4_inward.pdb Alignment file: A0A109DDE4_inw.pir Procheck score ⇒ Ramachandran plot: 92.1% favored 7.9% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A109DDE4_outward.pdb Alignment file: A0A109DDE4_out.pir Procheck score ⇒ Ramachandran plot: 92.1% favored 6.3% allowed 1.6% week .0% disallowed Occluded: Model structure: A0A109DDE4_occluded.pdb Alignment file: A0A109DDE4_occ.pir Procheck score ⇒ Ramachandran plot: 93.7% favored 4.8% allowed .8% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA