| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A103YMS8
dbSWEET id: dbswt_265
Accession: A0A103YMS8
Uniprot status: Unreviewed
Organism: Cynara cardunculus
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ campanulids ⇒ Asterales ⇒ Asteraceae ⇒ Carduoideae ⇒ Cardueae ⇒ Carduinae ⇒ Cynara.
Sequence Information back to top
Sequence length: 251
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVC CVV: 369 CHI: 10.1
Fasta sequence:
>tr|A0A103YMS8|A0A103YMS8_CYNCS|Unreviewed|Cynara_cardunculus|251
MLAFLNAHILAIVFGLLGNIISFLVFLAPLPTFYKIYRKKSSEGYQAIPYIVALFSAALL
LYYAFLKTNAYMIVCINGIGCLIEIAYLSVYLFYAPKRTKISTIKFISVFNIGGLGTVLV
LSLVLVKGPKRVELVGWTCAVINLAVFAAPLSIMRKVIRTKSVEYMPFMLSFSLTLCAIS
WFFYGFFVNDYYIAVPNVAGFLFGITQMVLYCVYKDSKKQSGSDSVEKPNKTGTDRENLE
VEVVVSDGHRH
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 4 Model end: 216
Alignment file: A0A103YMS8.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A103YMS8_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.6% favored 6.3% allowed .0% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A103YMS8_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.7% favored 5.3% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A103YMS8_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.5% favored 7.9% allowed .0% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA