Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A103YK64
dbSWEET id: dbswt_661
Accession: A0A103YK64
Uniprot status: Unreviewed
Organism: Cynara cardunculus
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ campanulids ⇒ Asterales ⇒ Asteraceae ⇒ Carduoideae ⇒ Cardueae ⇒ Carduinae ⇒ Cynara.
Sequence Information back to top
Sequence length: 230
Substrate Binding Site: CNFN CVV: 413 CHI: -1.7
Selectivity Filter: LNMM CVV: 468 CHI: 4.1
Fasta sequence:
>tr|A0A103YK64|A0A103YK64_CYNCS|Unreviewed|Cynara_cardunculus|230
MAMVSPQTFEVLKQAAGVAGNIFAFGLFVSPIPTFRRIIRNQSTEQFSGMPYIYALLNCL
ICAWYGCPFISSDNILVTTVNSVGAVFQLSYIIIYITCAEKRKKFKMSGLLLAVFGLFAV
IVIGSMLVSDLEVRHLVIGFLSCATLISMFASPLSVMNLVIQTRSVEFMPFYLSLSTFLM
STSFLLYGIFNFDPFIYVPNGIGTILGIAQLALYFYYNKKSNEESREPLI
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 6 Model end: 219
Alignment file: A0A103YK64.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A103YK64_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.2% favored 4.2% allowed .0% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A103YK64_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.7% favored 5.8% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A103YK64_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.5% favored 6.9% allowed 1.1% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA