Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A103Y8U4

dbSWEET id: dbswt_582

Accession:   A0A103Y8U4

Uniprot status:   Unreviewed

Organism:   Cynara cardunculus

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ campanulids ⇒ Asterales ⇒ Asteraceae ⇒ Carduoideae ⇒ Cardueae ⇒ Carduinae ⇒ Cynara.

Sequence Information back to top


Sequence length:   269

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LNMA           CVV:   411       CHI:   4

Fasta sequence:

>tr|A0A103Y8U4|A0A103Y8U4_CYNCS|Unreviewed|Cynara_cardunculus|269
MIVMLHLAVGLMEKCCVFVAGNAASFLLYAAPIWTFARVIRKKSTEEFSSVPYVISLLNC
LMYTWYGLPVVSHEWENFPMITINGLGILLELSFIIIFIWFASRKQKLKAGIMTTAVIII
FSITALISTYVFHDHHTRKELVGSVGLIASVAMYGSPLVVMKKVIETKSVEYMPFSLSFF
SFLASALWMAYGLLGRDLLIAAPNLVGCPLGALQLVLYCKYRNRVMEEPKPAQEWDVEKV
DKKTSKHVQIAVVTTDENINGKKSQIINS

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   7     Model end:   223

Alignment file: A0A103Y8U4.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A103Y8U4_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.2% favored    6.2% allowed    1.6% week    1.0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A103Y8U4_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.8% favored    4.7% allowed    .0% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A103Y8U4_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.7% favored    6.7% allowed    1.0% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur