Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A103XY00
dbSWEET id: dbswt_898
Accession: A0A103XY00
Uniprot status: Unreviewed
Organism: Cynara cardunculus
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ campanulids ⇒ Asterales ⇒ Asteraceae ⇒ Carduoideae ⇒ Cardueae ⇒ Carduinae ⇒ Cynara.
Sequence Information back to top
Sequence length: 226
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMN CVV: 440 CHI: -1.3
Fasta sequence:
>tr|A0A103XY00|A0A103XY00_CYNCS|Unreviewed|Cynara_cardunculus|226
MDRETIRLIVGIIGNVISLYLYLSPTPTFINIVKHKSVQAFKPDPYLATLLNCAMWLFYG
LPIVHPHSLLVVTVNSVGVVIAFTFCNIFFKYSTWICRVIFIAGMVAFTLIVEHTNDARS
MVVGLLCVIVNIIMYTAPLTVMKTVIKTKSVRYMPICLSFGNLLNGSIWVVYAALEFDPF
IMIPNVIGAISGIIQIALYVKYKKTTNWEDDEPPNELEMPPAPSNA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 204
Alignment file: A0A103XY00.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A103XY00_inward.pdb
Procheck score ⇒ Ramachandran plot: 91.7% favored 6.6% allowed 1.7% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A103XY00_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.8% favored 6.6% allowed .6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A103XY00_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.9% favored 5.0% allowed .6% week .6% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA