Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0Y7HNG2

dbSWEET id: dbswt_2018

Accession:   A0A0Y7HNG2

Uniprot status:   Unreviewed

Organism:   Listeria monocytogenes

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Bacillales ⇒ Listeriaceae ⇒ Listeria.

Sequence Information back to top


Sequence length:   90

Substrate Binding Site:   WNWN           CVV:   518       CHI:   -8.8

Selectivity Filter:   SFSF           CVV:   416       CHI:   4

Fasta sequence:

>tr|A0A0Y7HNG2|A0A0Y7HNG2_LISMN|Unreviewed|Listeria monocytogenes|90
MKKNKKVLHAIAVIASVMSVLMYVSYIPQIYGNLHGEKGNPTQPLVAMINCIFWTIHGLY
GDDGETRDKSIIFANVPGIIFGFFAFITAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   12     Model end:   91

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0Y7HNG2_inward.pdb    Alignment file: A0A0Y7HNG2_inw.pir

Procheck score ⇒ Ramachandran plot: 87.7% favored    12.3% allowed    .0% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0Y7HNG2_outward.pdb    Alignment file: A0A0Y7HNG2_out.pir

Procheck score ⇒ Ramachandran plot: 89.2% favored    10.0% allowed    .8% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0Y7HNG2_occluded.pdb    Alignment file: A0A0Y7HNG2_occ.pir

Procheck score ⇒ Ramachandran plot: 87.7% favored    11.5% allowed    .8% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur