Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0Y7HNG2
dbSWEET id: dbswt_2018
Accession: A0A0Y7HNG2
Uniprot status: Unreviewed
Organism: Listeria monocytogenes
Kingdom: Bacteria
Sequence Information back to top
Sequence length: 90
Substrate Binding Site: WNWN CVV: 518 CHI: -8.8
Selectivity Filter: SFSF CVV: 416 CHI: 4
Fasta sequence:
>tr|A0A0Y7HNG2|A0A0Y7HNG2_LISMN|Unreviewed|Listeria monocytogenes|90
MKKNKKVLHAIAVIASVMSVLMYVSYIPQIYGNLHGEKGNPTQPLVAMINCIFWTIHGLY
GDDGETRDKSIIFANVPGIIFGFFAFITAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 12 Model end: 91 Inward Open: Template: 4X5M.pdb Model structure: A0A0Y7HNG2_inward.pdb Alignment file: A0A0Y7HNG2_inw.pir Procheck score ⇒ Ramachandran plot: 87.7% favored 12.3% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0Y7HNG2_outward.pdb Alignment file: A0A0Y7HNG2_out.pir Procheck score ⇒ Ramachandran plot: 89.2% favored 10.0% allowed .8% week .0% disallowed Occluded: Model structure: A0A0Y7HNG2_occluded.pdb Alignment file: A0A0Y7HNG2_occ.pir Procheck score ⇒ Ramachandran plot: 87.7% favored 11.5% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA