| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0W0ZQY6
dbSWEET id: dbswt_1530
Accession: A0A0W0ZQY6
Uniprot status: Unreviewed
Organism: Legionella steelei
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Legionellales ⇒ Legionellaceae ⇒ Legionella.
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: SNSN CVV: 338 CHI: -8.6
Selectivity Filter: GCGC CVV: 268 CHI: 4.2
Fasta sequence:
>tr|A0A0W0ZQY6|A0A0W0ZQY6_9GAMM|Unreviewed|Legionella steelei|88
MSIVMFSGLIAFITSFIGLLPQIVKSLKTKSTQDLSMIMLINYLICSVAWIIYGSNTDSF
FVISSNVVGLIVSLLLILLKRYYDARCN
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 82 Inward Open: Template: 4X5M.pdb Model structure: A0A0W0ZQY6_inward.pdb Alignment file: A0A0W0ZQY6_inw.pir Procheck score ⇒ Ramachandran plot: 93.6% favored 5.0% allowed 1.4% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0W0ZQY6_outward.pdb Alignment file: A0A0W0ZQY6_out.pir Procheck score ⇒ Ramachandran plot: 92.9% favored 7.1% allowed .0% week .0% disallowed Occluded: Model structure: A0A0W0ZQY6_occluded.pdb Alignment file: A0A0W0ZQY6_occ.pir Procheck score ⇒ Ramachandran plot: 92.1% favored 7.9% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA