Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0W0ZQY6

dbSWEET id: dbswt_1530

Accession:   A0A0W0ZQY6

Uniprot status:   Unreviewed

Organism:   Legionella steelei

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Legionellales ⇒ Legionellaceae ⇒ Legionella.

Sequence Information back to top


Sequence length:   88

Substrate Binding Site:   SNSN           CVV:   338       CHI:   -8.6

Selectivity Filter:   GCGC           CVV:   268       CHI:   4.2

Fasta sequence:

>tr|A0A0W0ZQY6|A0A0W0ZQY6_9GAMM|Unreviewed|Legionella steelei|88
MSIVMFSGLIAFITSFIGLLPQIVKSLKTKSTQDLSMIMLINYLICSVAWIIYGSNTDSF
FVISSNVVGLIVSLLLILLKRYYDARCN

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   82

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0W0ZQY6_inward.pdb    Alignment file: A0A0W0ZQY6_inw.pir

Procheck score ⇒ Ramachandran plot: 93.6% favored    5.0% allowed    1.4% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0W0ZQY6_outward.pdb    Alignment file: A0A0W0ZQY6_out.pir

Procheck score ⇒ Ramachandran plot: 92.9% favored    7.1% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0W0ZQY6_occluded.pdb    Alignment file: A0A0W0ZQY6_occ.pir

Procheck score ⇒ Ramachandran plot: 92.1% favored    7.9% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur