| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0W0YQD9
dbSWEET id: dbswt_1526
Accession: A0A0W0YQD9
Uniprot status: Unreviewed
Organism: Legionella shakespearei
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Legionellales ⇒ Legionellaceae ⇒ Legionella.
Sequence Information back to top
Sequence length: 90
Substrate Binding Site: SNSN CVV: 338 CHI: -8.6
Selectivity Filter: GCGC CVV: 268 CHI: 4.2
Fasta sequence:
>tr|A0A0W0YQD9|A0A0W0YQD9_9GAMM|Unreviewed|Legionella shakespearei|90
MTLIFISGTIAFITSFIGLLPQIFKAIKTKSTQDISMIMLINYLICSLAWIVYGGSTDSF
FVLSSNVVGLIISLLLIILKRRYDSRTVQL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 82 Inward Open: Template: 4X5M.pdb Model structure: A0A0W0YQD9_inward.pdb Alignment file: A0A0W0YQD9_inw.pir Procheck score ⇒ Ramachandran plot: 94.2% favored 5.1% allowed .7% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0W0YQD9_outward.pdb Alignment file: A0A0W0YQD9_out.pir Procheck score ⇒ Ramachandran plot: 93.5% favored 6.5% allowed .0% week .0% disallowed Occluded: Model structure: A0A0W0YQD9_occluded.pdb Alignment file: A0A0W0YQD9_occ.pir Procheck score ⇒ Ramachandran plot: 94.2% favored 5.8% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR006603: PQ-loop_rpt. IPR004316: SWEET_sugar_transpr.
Panther: NA