Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0W0YJP5
dbSWEET id: dbswt_1525
Accession: A0A0W0YJP5
Uniprot status: Unreviewed
Organism: Legionella sainthelensi
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Legionellales ⇒ Legionellaceae ⇒ Legionella.
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: SNSN CVV: 338 CHI: -8.6
Selectivity Filter: GCGC CVV: 268 CHI: 4.2
Fasta sequence:
>tr|A0A0W0YJP5|A0A0W0YJP5_9GAMM|Unreviewed|Legionella sainthelensi|88
MSIVMLSGVVAFITSFIGLLPQIVKSLKTRSTQDISMMMLINYLVCSLAWIIYGSSTNSF
FVISSNVVGLIISLLLILLKRHYDARCT
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 5 Model end: 82 Inward Open: Template: 4X5M.pdb Model structure: A0A0W0YJP5_inward.pdb Alignment file: A0A0W0YJP5_inw.pir Procheck score ⇒ Ramachandran plot: 92.1% favored 5.7% allowed 1.4% week .7% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0W0YJP5_outward.pdb Alignment file: A0A0W0YJP5_out.pir Procheck score ⇒ Ramachandran plot: 95.0% favored 4.3% allowed .7% week .0% disallowed Occluded: Model structure: A0A0W0YJP5_occluded.pdb Alignment file: A0A0W0YJP5_occ.pir Procheck score ⇒ Ramachandran plot: 95.7% favored 3.6% allowed .0% week .7% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA