| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0W0UFH2
dbSWEET id: dbswt_1522
Accession: A0A0W0UFH2
Uniprot status: Unreviewed
Organism: Legionella gratiana
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Legionellales ⇒ Legionellaceae ⇒ Legionella.
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: SNSN CVV: 338 CHI: -8.6
Selectivity Filter: GCGC CVV: 268 CHI: 4.2
Fasta sequence:
>tr|A0A0W0UFH2|A0A0W0UFH2_9GAMM|Unreviewed|Legionella gratiana|88
MSIVMLSGVVAFITSFIGLLPQIVKSLKTRSTQDLSMVMLINYLVCSLAWIIYGSSTNSF
FVISSNIVGLVISLLLILLKKHYDARCN
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 82 Inward Open: Template: 4X5M.pdb Model structure: A0A0W0UFH2_inward.pdb Alignment file: A0A0W0UFH2_inw.pir Procheck score ⇒ Ramachandran plot: 94.3% favored 3.6% allowed 1.4% week .7% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0W0UFH2_outward.pdb Alignment file: A0A0W0UFH2_out.pir Procheck score ⇒ Ramachandran plot: 90.7% favored 7.1% allowed .7% week 1.4% disallowed Occluded: Model structure: A0A0W0UFH2_occluded.pdb Alignment file: A0A0W0UFH2_occ.pir Procheck score ⇒ Ramachandran plot: 95.7% favored 4.3% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA