Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0W0RYU4
dbSWEET id: dbswt_1517
Accession: A0A0W0RYU4
Uniprot status: Unreviewed
Organism: Legionella anisa
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Legionellales ⇒ Legionellaceae ⇒ Legionella.
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: SNSN CVV: 338 CHI: -8.6
Selectivity Filter: GCGC CVV: 268 CHI: 4.2
Fasta sequence:
>tr|A0A0W0RYU4|A0A0W0RYU4_9GAMM|Unreviewed|Legionella anisa|88
MSIVLFSGIVAFITSFIGLLPQIIKSLKTKSTQDLSMIMLINYLICSVAWIIYGSSTDSF
FVISSNVVGLLVSLLLILLKKHYDARSH
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 5 Model end: 82 Inward Open: Template: 4X5M.pdb Model structure: A0A0W0RYU4_inward.pdb Alignment file: A0A0W0RYU4_inw.pir Procheck score ⇒ Ramachandran plot: 90.0% favored 8.6% allowed 1.4% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0W0RYU4_outward.pdb Alignment file: A0A0W0RYU4_out.pir Procheck score ⇒ Ramachandran plot: 89.3% favored 10.0% allowed .7% week .0% disallowed Occluded: Model structure: A0A0W0RYU4_occluded.pdb Alignment file: A0A0W0RYU4_occ.pir Procheck score ⇒ Ramachandran plot: 93.6% favored 6.4% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA