Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0W0RS07
dbSWEET id: dbswt_1516
Accession: A0A0W0RS07
Uniprot status: Unreviewed
Organism: Fluoribacter bozemanae
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Gammaproteobacteria ⇒ Legionellales ⇒ Legionellaceae ⇒ Fluoribacter.
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: SNSN CVV: 338 CHI: -8.6
Selectivity Filter: GCGC CVV: 268 CHI: 4.2
Fasta sequence:
>tr|A0A0W0RS07|A0A0W0RS07_FLUBO|Unreviewed|Fluoribacter bozemanae|88
MSIVLFSGIVAFITSFIGLLPQIIKSLKTKSTQDLSMIMLINYLVCSVAWIIYGSSTDSF
FVLSANVVGLLVSLLLILLKRHYDARCN
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 5 Model end: 82 Inward Open: Template: 4X5M.pdb Model structure: A0A0W0RS07_inward.pdb Alignment file: A0A0W0RS07_inw.pir Procheck score ⇒ Ramachandran plot: 95.0% favored 3.6% allowed 1.4% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0W0RS07_outward.pdb Alignment file: A0A0W0RS07_out.pir Procheck score ⇒ Ramachandran plot: 92.9% favored 7.1% allowed .0% week .0% disallowed Occluded: Model structure: A0A0W0RS07_occluded.pdb Alignment file: A0A0W0RS07_occ.pir Procheck score ⇒ Ramachandran plot: 94.3% favored 5.7% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA