Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0V8DFI1

dbSWEET id: dbswt_1514

Accession:   A0A0V8DFI1

Uniprot status:   Unreviewed

Organism:   Lactococcus lactis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Lactococcus.

Sequence Information back to top


Sequence length:   86

Substrate Binding Site:   CACA           CVV:   306       CHI:   8.6

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|A0A0V8DFI1|A0A0V8DFI1_LACLL|Unreviewed|Lactococcus lactis|86
MNQEKFIKYLSWVATGMSVMMYVSFLPQIANNLSGMKGNPIQPLVAAINCTLWVTYGIGK
KPRDLALATANFPGIIFGLVTFFTAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   11     Model end:   86

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0V8DFI1_inward.pdb    Alignment file: A0A0V8DFI1_inw.pir

Procheck score ⇒ Ramachandran plot: 86.9% favored    10.7% allowed    1.6% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0V8DFI1_outward.pdb    Alignment file: A0A0V8DFI1_out.pir

Procheck score ⇒ Ramachandran plot: 91.8% favored    8.2% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0V8DFI1_occluded.pdb    Alignment file: A0A0V8DFI1_occ.pir

Procheck score ⇒ Ramachandran plot: 91.0% favored    7.4% allowed    1.6% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur