Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0V7ZSK7

dbSWEET id: dbswt_1511

Accession:   A0A0V7ZSK7

Uniprot status:   Unreviewed

Organism:   Mastigocoleus testarum

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Cyanobacteria ⇒ Nostocales ⇒ Hapalosiphonaceae ⇒ Mastigocoleus.

Sequence Information back to top


Sequence length:   92

Substrate Binding Site:   VNVN           CVV:   402       CHI:   1.4

Selectivity Filter:   SGSG           CVV:   242       CHI:   -2.4

Fasta sequence:

>tr|A0A0V7ZSK7|A0A0V7ZSK7_9CYAN|Unreviewed|Mastigocoleus testarum|92
MNYLTVLGLSAATLTTISFLPQMVKTWQTKSAKDVSYIMLITFILGVSLWLLYGILRQDI
AIVLANAITLVFNLTILWLKIKYGKTRPRKYL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   82

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0V7ZSK7_inward.pdb    Alignment file: A0A0V7ZSK7_inw.pir

Procheck score ⇒ Ramachandran plot: 93.7% favored    4.9% allowed    1.4% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0V7ZSK7_outward.pdb    Alignment file: A0A0V7ZSK7_out.pir

Procheck score ⇒ Ramachandran plot: 94.4% favored    5.6% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0V7ZSK7_occluded.pdb    Alignment file: A0A0V7ZSK7_occ.pir

Procheck score ⇒ Ramachandran plot: 97.2% favored    2.8% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur