Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0V1M5E6

dbSWEET id: dbswt_1092

Accession:   A0A0V1M5E6

Uniprot status:   Unreviewed

Organism:   Trichinella papuae

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Enoplea ⇒ Dorylaimia ⇒ Trichocephalida ⇒ Trichinellidae ⇒ Trichinella.

Sequence Information back to top


Sequence length:   242

Substrate Binding Site:   SNVN           CVV:   370       CHI:   -3.6

Selectivity Filter:   AGCI           CVV:   325       CHI:   8.4

Fasta sequence:

>tr|A0A0V1M5E6|A0A0V1M5E6_9BILA|Unreviewed|Trichinella_papuae|242
MNSTSVPLKKQLQIFYKDFPKSLLRHLNFFDLLCTSIGINIFFLGLAALSNIRRWRKRGK
SDQDFFLPFILAWIGSFLWTVYGFLVTNWQIELVNGYLTAANSVVLIALYIYRIRKKSLA
AVIFITGLAAGSLLLLLTQLPNITSVHLVGSICSCMQIGCACTMLYMIVLAIKKKRIDFI
PFLPVAQIFNIEFQVTLYSIWIEDFYLLISNGIFMTIDGLVFLLFFIYPSEPTVKEKAES
LI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   26     Model end:   230

Alignment file: A0A0V1M5E6.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0V1M5E6_inward.pdb

Procheck score ⇒ Ramachandran plot: 88.2% favored    8.1% allowed    2.7% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0V1M5E6_outward.pdb

Procheck score ⇒ Ramachandran plot: 88.7% favored    10.2% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0V1M5E6_occluded.pdb

Procheck score ⇒ Ramachandran plot: 86.0% favored    11.8% allowed    1.6% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur