Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0V1KTJ4

dbSWEET id: dbswt_1091

Accession:   A0A0V1KTJ4

Uniprot status:   Unreviewed

Organism:   Trichinella nativa

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Enoplea ⇒ Dorylaimia ⇒ Trichocephalida ⇒ Trichinellidae ⇒ Trichinella.

Sequence Information back to top


Sequence length:   242

Substrate Binding Site:   SNVN           CVV:   370       CHI:   -3.6

Selectivity Filter:   AGCI           CVV:   325       CHI:   8.4

Fasta sequence:

>tr|A0A0V1KTJ4|A0A0V1KTJ4_9BILA|Unreviewed|Trichinella_nativa|242
MNSTSVPLEKQLQILYKDFPKSLLRHLNFFDLLCTSIGINIFFLGLAALSNIRRWKMRGK
SDQDFFLPFILAWIGSFLWTVYGFLVTNWQIELVNGYLTAANSVVLIALYIYRIRKKSLA
AVIFITGLATGSLLLLLAQLPNITSVHLVGSICSCIQIGCACTMLYMIVLAIKKKRIDFI
PFPPVAQIFNIEFQVTLYSIWIEDFYLLISNGIFMTIDGLVFLLFFIYPSEPTVKEKAES
LI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   26     Model end:   230

Alignment file: A0A0V1KTJ4.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0V1KTJ4_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.4% favored    5.9% allowed    .5% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0V1KTJ4_outward.pdb

Procheck score ⇒ Ramachandran plot: 90.8% favored    7.6% allowed    1.1% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0V1KTJ4_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.9% favored    6.5% allowed    1.1% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur