| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0V1JB62
dbSWEET id: dbswt_1291
Accession: A0A0V1JB62
Uniprot status: Unreviewed
Organism: Trichinella pseudospiralis
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Enoplea ⇒ Dorylaimia ⇒ Trichocephalida ⇒ Trichinellidae ⇒ Trichinella.
Sequence Information back to top
Sequence length: 390
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: MSNV CVV: 398 CHI: 1.8
Fasta sequence:
>tr|A0A0V1JB62|A0A0V1JB62_TRIPS|Unreviewed|Trichinella_pseudospiralis|390
MPCHQQSCRRKNTLADFCCRLLDVSEIAVNSYYSVKQSFTLAGECGQMLPSCSMLMWHAA
AAIPVSVLTSGIMSQQYPDMCNVTDERFECFAFFKNAINFIQSSVELLCNEITINKQPVQ
YILLFEFVFFLVQQHRFHLICFCLSNEQFKFALLLHKHLSCGLAQLTNVGQFQHTTSMEL
QFLDLLSISATFSTIGMFLVGIPMCKSIIRKKSSEGVSPVPFAMCAVSCFFWLQYGILKH
DRTIVLINLVGFILQVLYYMVLYSHSKQKSFIHLIMLAAILSCSALQYYLMKSTNHNTTL
NNLGKMCLVLNVLNFASPLAVLKEVIKSKSCESLPLPLCAANLIVAAQWFLYGLLVSDPY
IKIPNMIGIALAVFQLSLFFIFPKERAHHG
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 176 Model end: 384
Alignment file: A0A0V1JB62.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0V1JB62_inward.pdb
Procheck score ⇒ Ramachandran plot: 87.9% favored 9.5% allowed 2.1% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0V1JB62_outward.pdb
Procheck score ⇒ Ramachandran plot: 88.9% favored 9.5% allowed 1.1% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0V1JB62_occluded.pdb
Procheck score ⇒ Ramachandran plot: 89.5% favored 8.4% allowed 1.6% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA