Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0V1FLS8

dbSWEET id: dbswt_1288

Accession:   A0A0V1FLS8

Uniprot status:   Unreviewed

Organism:   Trichinella pseudospiralis

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Enoplea ⇒ Dorylaimia ⇒ Trichocephalida ⇒ Trichinellidae ⇒ Trichinella.

Sequence Information back to top


Sequence length:   313

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   MSNV           CVV:   398       CHI:   1.8

Fasta sequence:

>tr|A0A0V1FLS8|A0A0V1FLS8_TRIPS|Unreviewed|Trichinella_pseudospiralis|313
MLMWHAAAAIPVSVLTSGIMSQQYPDMLELLCNEITINKQPVQYILLFEFVFFLVQQHRF
HLICFCLSNEQFKFALLLHKHLSCGLAQLTNVGQFQHTTSMELQFLDLLSISATFSTIGM
FLVGIPMCKSIIRKKSSEGVSPVPFAMCAVSCFFWLQYGILKHDRTIVLINLVGFILQVL
YYMVLYSHSKQKSFIHLIMLAAILSCSALQYYLMKSTNHNTTLNNLGKMCLVLNVLNFAS
PLAVLKEVIKSKSCESLPLPLCAANLIVAAQWFLYGLLVSDPYIKIPNMIGIALAVFQLS
LFFIFPKERAHHG

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   99     Model end:   307

Alignment file: A0A0V1FLS8.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0V1FLS8_inward.pdb

Procheck score ⇒ Ramachandran plot: 87.9% favored    9.5% allowed    2.1% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0V1FLS8_outward.pdb

Procheck score ⇒ Ramachandran plot: 88.9% favored    10.0% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0V1FLS8_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.5% favored    8.4% allowed    1.6% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur