Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0V1CF73

dbSWEET id: dbswt_1089

Accession:   A0A0V1CF73

Uniprot status:   Unreviewed

Organism:   Trichinella britovi

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Enoplea ⇒ Dorylaimia ⇒ Trichocephalida ⇒ Trichinellidae ⇒ Trichinella.

Sequence Information back to top


Sequence length:   242

Substrate Binding Site:   SGVN           CVV:   322       CHI:   -0.5

Selectivity Filter:   AGCI           CVV:   325       CHI:   8.4

Fasta sequence:

>tr|A0A0V1CF73|A0A0V1CF73_TRIBR|Unreviewed|Trichinella_britovi|242
MNSTSVPLEKQLQILYKDFPKSLLRHLNFFDLLCTSIGINIFFLGLAALSNIRRWKMRGK
SDQDFFLPFILAWIGSFLWTVYGFLVTNWQIELVNGYLTAANSVVLIALYIYRIRKKSLA
AVIFITGLATGSLLLLLAQLPNITSVHLVGSICSCIQIGCACTMLYMIVLAIKKKRIDFI
PFPPVAQIFNIEFQVTLYSIWIEDFYLLISNGIFMTIDGLVFLLFFIYPSEPTVKEKAES
LI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   27     Model end:   230

Alignment file: A0A0V1CF73.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0V1CF73_inward.pdb

Procheck score ⇒ Ramachandran plot: 89.7% favored    7.6% allowed    2.2% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0V1CF73_outward.pdb

Procheck score ⇒ Ramachandran plot: 89.1% favored    10.3% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0V1CF73_occluded.pdb

Procheck score ⇒ Ramachandran plot: 90.2% favored    8.7% allowed    .5% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur