Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0V1B968

dbSWEET id: dbswt_1087

Accession:   A0A0V1B968

Uniprot status:   Unreviewed

Organism:   Trichinella spiralis

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Enoplea ⇒ Dorylaimia ⇒ Trichocephalida ⇒ Trichinellidae ⇒ Trichinella.

Sequence Information back to top


Sequence length:   247

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   MSNV           CVV:   398       CHI:   1.8

Fasta sequence:

>tr|A0A0V1B968|A0A0V1B968_TRISP|Unreviewed|Trichinella_spiralis|247
LCSFFFILQQMTSMELQFLDLLSISATFSTIGMFLVGIPMCKSIIRKKSSEGVSPVPFAM
CAVSCFFWLQYGILKHDRTIVLINLVGFILQVLYYAVLYSHSKQKNFIHLIMLAGILACS
ALQYYLMKSTNHNTTLNNLGKMCLVLNVLNFASPLAVLVNSSNWKSIYCRCNSIFFLLQK
EVIKTKSCECLPLPLCAANLIVAAQWFLYGLLVSDPYIKIPNMIGIALAVFQLSLFFIFP
KERAHRG

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   12     Model end:   241

Alignment file: A0A0V1B968.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0V1B968_inward.pdb

Procheck score ⇒ Ramachandran plot: 89.0% favored    8.6% allowed    .5% week    1.9% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0V1B968_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.0% favored    6.2% allowed    1.0% week    1.9% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0V1B968_occluded.pdb

Procheck score ⇒ Ramachandran plot: 88.6% favored    8.6% allowed    1.9% week    1.0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur