Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0V0RU37

dbSWEET id: dbswt_1085

Accession:   A0A0V0RU37

Uniprot status:   Unreviewed

Organism:   Trichinella nelsoni

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Enoplea ⇒ Dorylaimia ⇒ Trichocephalida ⇒ Trichinellidae ⇒ Trichinella.

Sequence Information back to top


Sequence length:   247

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   MSNV           CVV:   398       CHI:   1.8

Fasta sequence:

>tr|A0A0V0RU37|A0A0V0RU37_9BILA|Unreviewed|Trichinella_nelsoni|247
LCSFFFILQQMTSMELQFLDLLSISATFSTIGMFLVGIPMCKSIIRKKSSEGVSPVPFAM
CAVSCFFWLQYGILKHDRTIVLINLVGFILQVLYYAVLYSHSKQKNFIHLIMLAGILACS
ALQYYLMKSTNHNTTLNNLGKMCLVLNVLNFASPLAVLVNGSNWKSIYCRCNSIFFLLQK
EVIKTKSCECLPLPLCAANLIVAAQWFLYGLLVSDPYIKIPNMIGIALAVFQLSLFFIFP
KERAHRG

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   12     Model end:   241

Alignment file: A0A0V0RU37.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0V0RU37_inward.pdb

Procheck score ⇒ Ramachandran plot: 86.1% favored    10.5% allowed    2.4% week    1.0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0V0RU37_outward.pdb

Procheck score ⇒ Ramachandran plot: 88.5% favored    9.6% allowed    1.0% week    1.0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0V0RU37_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.5% favored    9.1% allowed    1.0% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur