Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0V0G7F3

dbSWEET id: dbswt_1083

Accession:   A0A0V0G7F3

Uniprot status:   Unreviewed

Organism:   Triatoma dimidiata

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Paraneoptera ⇒ Hemiptera ⇒ Euhemiptera ⇒ Heteroptera ⇒ Panheteroptera ⇒ Cimicomorpha ⇒ Reduviidae ⇒ Triatominae ⇒ Triatoma.

Sequence Information back to top


Sequence length:   207

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   QSFV           CVV:   427       CHI:   2.7

Fasta sequence:

>tr|A0A0V0G7F3|A0A0V0G7F3_TRIDM|Unreviewed|Triatoma_dimidiata|207
LEDFKQVLVTCASVCQILQFMSGILVCEKFMKKGTSNDISPFPFVCGVTSCILWATYANL
INDTALIFVNIFGALLMFSYIVAYYLFAPRKGPLLKQLLIVTSVITITQVYIHSIDELEK
ATSHLGIICCSVTLTFFAAPLANLAHVIRVQSSESLPFPLILMSLVVTAQWSLYGYILKD
KFITYPNVLGFLLSCFQLSLFAVYPFR

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   206

Alignment file: A0A0V0G7F3.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0V0G7F3_inward.pdb

Procheck score ⇒ Ramachandran plot: 90.4% favored    8.0% allowed    1.1% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0V0G7F3_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.6% favored    5.3% allowed    .0% week    1.1% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0V0G7F3_occluded.pdb

Procheck score ⇒ Ramachandran plot: 90.9% favored    8.0% allowed    1.1% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur