Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0U3AU67
dbSWEET id: dbswt_1508
Accession: A0A0U3AU67
Uniprot status: Unreviewed
Organism: Herbaspirillum rubrisubalbicans
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Betaproteobacteria ⇒ Burkholderiales ⇒ Oxalobacteraceae ⇒ Herbaspirillum.
Sequence Information back to top
Sequence length: 107
Substrate Binding Site: SLSL CVV: 394 CHI: 6
Selectivity Filter: TATA CVV: 320 CHI: 2.2
Fasta sequence:
>tr|A0A0U3AU67|A0A0U3AU67_9BURK|Unreviewed|Herbaspirillum rubrisubalbicans| 107
MLCGPLAAFTITMSDHITDLIGWGATLILLLTISSQVYEQWRSRSTQGVSHWLFAGQLAA
SAGFVTYSLLQGDWVFVVSNVFLLLTALLGQVLYLRNRRRQQGGSQA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 19 Model end: 99 Inward Open: Template: 4X5M.pdb Model structure: A0A0U3AU67_inward.pdb Alignment file: A0A0U3AU67_inw.pir Procheck score ⇒ Ramachandran plot: 91.5% favored 6.3% allowed 2.1% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0U3AU67_outward.pdb Alignment file: A0A0U3AU67_out.pir Procheck score ⇒ Ramachandran plot: 90.1% favored 9.2% allowed .7% week .0% disallowed Occluded: Model structure: A0A0U3AU67_occluded.pdb Alignment file: A0A0U3AU67_occ.pir Procheck score ⇒ Ramachandran plot: 94.4% favored 4.9% allowed .7% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA