Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0U3AU67

dbSWEET id: dbswt_1508

Accession:   A0A0U3AU67

Uniprot status:   Unreviewed

Organism:   Herbaspirillum rubrisubalbicans

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Betaproteobacteria ⇒ Burkholderiales ⇒ Oxalobacteraceae ⇒ Herbaspirillum.

Sequence Information back to top


Sequence length:   107

Substrate Binding Site:   SLSL           CVV:   394       CHI:   6

Selectivity Filter:   TATA           CVV:   320       CHI:   2.2

Fasta sequence:

>tr|A0A0U3AU67|A0A0U3AU67_9BURK|Unreviewed|Herbaspirillum rubrisubalbicans| 107
MLCGPLAAFTITMSDHITDLIGWGATLILLLTISSQVYEQWRSRSTQGVSHWLFAGQLAA
SAGFVTYSLLQGDWVFVVSNVFLLLTALLGQVLYLRNRRRQQGGSQA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   19     Model end:   99

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0U3AU67_inward.pdb    Alignment file: A0A0U3AU67_inw.pir

Procheck score ⇒ Ramachandran plot: 91.5% favored    6.3% allowed    2.1% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0U3AU67_outward.pdb    Alignment file: A0A0U3AU67_out.pir

Procheck score ⇒ Ramachandran plot: 90.1% favored    9.2% allowed    .7% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0U3AU67_occluded.pdb    Alignment file: A0A0U3AU67_occ.pir

Procheck score ⇒ Ramachandran plot: 94.4% favored    4.9% allowed    .7% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur