Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0U1AZV3
dbSWEET id: dbswt_1507
Accession: A0A0U1AZV3
Uniprot status: Unreviewed
Organism: Mycobacterium abscessus
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Actinobacteria ⇒ Corynebacteriales ⇒ Mycobacteriaceae ⇒ Mycobacterium.
Sequence Information back to top
Sequence length: 90
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0U1AZV3|A0A0U1AZV3_9MYCO|Unreviewed|Mycobacterium abscessus|90
MKKNKKALHAIAVIASVMSVLMYVSYIPQIYGNLHGEKGNPTQPLVAMINCIFWTIHGLY
GDDGETRDKSIIFANVPGIIFGFFAFITAL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 12 Model end: 91 Inward Open: Template: 4X5M.pdb Model structure: A0A0U1AZV3_inward.pdb Alignment file: A0A0U1AZV3_inw.pir Procheck score ⇒ Ramachandran plot: 88.5% favored 6.2% allowed 3.1% week 2.3% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0U1AZV3_outward.pdb Alignment file: A0A0U1AZV3_out.pir Procheck score ⇒ Ramachandran plot: 86.2% favored 10.8% allowed 1.5% week 1.5% disallowed Occluded: Model structure: A0A0U1AZV3_occluded.pdb Alignment file: A0A0U1AZV3_occ.pir Procheck score ⇒ Ramachandran plot: 93.1% favored 6.2% allowed .0% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA