| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0U0XF83
dbSWEET id: dbswt_1506
Accession: A0A0U0XF83
Uniprot status: Unreviewed
Organism: Chlamydia trachomatis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Chlamydiae ⇒ Chlamydiales ⇒ Chlamydiaceae ⇒ Chlamydia/Chlamydophila group ⇒ Chlamydia.
Sequence Information back to top
Sequence length: 111
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0U0XF83|A0A0U0XF83_CHLTH|Unreviewed|Chlamydia trachomatis| 111
MIFAIDSSFSYNEAQRSDLLKKFKGLDRKTVLTIGRIGSVLSVLMYVSYIPQIINNLNGN
YGNPVQPLVAAINCTIWVLYAILGEKKDWPLFTANFPGIIFGLITFFTSLH
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 35 Model end: 111 Inward Open: Template: 4X5M.pdb Model structure: A0A0U0XF83_inward.pdb Alignment file: A0A0U0XF83_inw.pir Procheck score ⇒ Ramachandran plot: 87.3% favored 10.3% allowed 2.4% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0U0XF83_outward.pdb Alignment file: A0A0U0XF83_out.pir Procheck score ⇒ Ramachandran plot: 89.7% favored 9.5% allowed .0% week .8% disallowed Occluded: Model structure: A0A0U0XF83_occluded.pdb Alignment file: A0A0U0XF83_occ.pir Procheck score ⇒ Ramachandran plot: 92.1% favored 7.9% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA