Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0T9RGP4
dbSWEET id: dbswt_1505
Accession: A0A0T9RGP4
Uniprot status: Unreviewed
Organism: Mycobacterium tuberculosis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Actinobacteria ⇒ Corynebacteriales ⇒ Mycobacteriaceae ⇒ Mycobacterium ⇒ Mycobacterium tuberculosis complex.
Sequence Information back to top
Sequence length: 111
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: FNFN CVV: 462 CHI: -1.4
Fasta sequence:
>tr|A0A0T9RGP4|A0A0T9RGP4_MYCTX|Unreviewed|Mycobacterium tuberculosis| 111
MAEQNNTSTSAQNSSPKGGLSAESEFHAKFFPILARVASVTAVLMYVFYFPQIIGNLNGH
KGDWIQPLVATVNCTLWVLYGLWRPKKDVPIIIANAPGIVFGGLAAVTALI
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 35 Model end: 111 Inward Open: Template: 4X5M.pdb Model structure: A0A0T9RGP4_inward.pdb Alignment file: A0A0T9RGP4_inw.pir Procheck score ⇒ Ramachandran plot: 92.7% favored 5.6% allowed .8% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0T9RGP4_outward.pdb Alignment file: A0A0T9RGP4_out.pir Procheck score ⇒ Ramachandran plot: 91.9% favored 4.8% allowed 1.6% week 1.6% disallowed Occluded: Model structure: A0A0T9RGP4_occluded.pdb Alignment file: A0A0T9RGP4_occ.pir Procheck score ⇒ Ramachandran plot: 93.5% favored 5.6% allowed .0% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA