Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0T9RGP4

dbSWEET id: dbswt_1505

Accession:   A0A0T9RGP4

Uniprot status:   Unreviewed

Organism:   Mycobacterium tuberculosis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Actinobacteria ⇒ Corynebacteriales ⇒ Mycobacteriaceae ⇒ Mycobacterium ⇒ Mycobacterium tuberculosis complex.

Sequence Information back to top


Sequence length:   111

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   FNFN           CVV:   462       CHI:   -1.4

Fasta sequence:

>tr|A0A0T9RGP4|A0A0T9RGP4_MYCTX|Unreviewed|Mycobacterium tuberculosis| 111
MAEQNNTSTSAQNSSPKGGLSAESEFHAKFFPILARVASVTAVLMYVFYFPQIIGNLNGH
KGDWIQPLVATVNCTLWVLYGLWRPKKDVPIIIANAPGIVFGGLAAVTALI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   35     Model end:   111

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0T9RGP4_inward.pdb    Alignment file: A0A0T9RGP4_inw.pir

Procheck score ⇒ Ramachandran plot: 92.7% favored    5.6% allowed    .8% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0T9RGP4_outward.pdb    Alignment file: A0A0T9RGP4_out.pir

Procheck score ⇒ Ramachandran plot: 91.9% favored    4.8% allowed    1.6% week    1.6% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0T9RGP4_occluded.pdb    Alignment file: A0A0T9RGP4_occ.pir

Procheck score ⇒ Ramachandran plot: 93.5% favored    5.6% allowed    .0% week    .8% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur