Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0T9PSP3

dbSWEET id: dbswt_1504

Accession:   A0A0T9PSP3

Uniprot status:   Unreviewed

Organism:   Mycobacterium tuberculosis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Actinobacteria ⇒ Corynebacteriales ⇒ Mycobacteriaceae ⇒ Mycobacterium ⇒ Mycobacterium tuberculosis complex.

Sequence Information back to top


Sequence length:   109

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   FNFN           CVV:   462       CHI:   -1.4

Fasta sequence:

>tr|A0A0T9PSP3|A0A0T9PSP3_MYCTX|Unreviewed|Mycobacterium tuberculosis| 109
MAEQNNTSAQNSSPKGGLSAESEFHAKFFPILARVASVTAVLMYVFYFPQIIGNLSGHKG
DWIQPLVAAINCTLWVLYGLWRPKKDVPIIIANAPGIVFGGLAAITALI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   33     Model end:   109

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0T9PSP3_inward.pdb    Alignment file: A0A0T9PSP3_inw.pir

Procheck score ⇒ Ramachandran plot: 89.5% favored    8.9% allowed    1.6% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0T9PSP3_outward.pdb    Alignment file: A0A0T9PSP3_out.pir

Procheck score ⇒ Ramachandran plot: 88.7% favored    9.7% allowed    .8% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0T9PSP3_occluded.pdb    Alignment file: A0A0T9PSP3_occ.pir

Procheck score ⇒ Ramachandran plot: 89.5% favored    8.9% allowed    .0% week    1.6% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur