Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0T6AYS0

dbSWEET id: dbswt_1082

Accession:   A0A0T6AYS0

Uniprot status:   Unreviewed

Organism:   Oryctes borbonicus

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Coleoptera ⇒ Polyphaga ⇒ Scarabaeiformia ⇒ Scarabaeidae ⇒ Dynastinae ⇒ Oryctes.

Sequence Information back to top


Sequence length:   216

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   QSFV           CVV:   427       CHI:   2.7

Fasta sequence:

>tr|A0A0T6AYS0|A0A0T6AYS0_9SCAR|Unreviewed|Oryctes_borbonicus|216
MNGDTIRNLLATTASISTLIQFLSGLFICKMIARKRGTGDMSPFPFISGHLSTSLWLRYG
LLINDFSLIFVNTIGSTLFLGYVVVFYYYSIKRSMIVKQFTGCMLLLVTTVLYSVWSEDV
LMVRRNIGTLCCVITVVFFAAPLTSVIHVLKTKSTDSLPFPIILTGFIVTSQWYAYGVLL
KDEFIQIPNFLGTVLTFSQLCLFCIYPSKNQDIEVV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   208

Alignment file: A0A0T6AYS0.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0T6AYS0_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.5% favored    3.8% allowed    2.2% week    1.6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0T6AYS0_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.4% favored    6.5% allowed    2.2% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0T6AYS0_occluded.pdb

Procheck score ⇒ Ramachandran plot: 90.3% favored    7.5% allowed    1.1% week    1.1% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur