Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0T5ZCX2
dbSWEET id: dbswt_2055
Accession: A0A0T5ZCX2
Uniprot status: Unreviewed
Organism: Thaumarchaeota archaeon
Kingdom: Archaea
Sequence Information back to top
Sequence length: 94
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: GGGG CVV: 192 CHI: -1.6
Fasta sequence:
>tr|A0A0T5ZCX2|A0A0T5ZCX2_9ARCH|Unreviewed|Thaumarchaeota archaeon|94
MLFDELSLGILATVAGIIILAGWVPQIIKGYRTKMLKDVSKYLMILIAVGAFLWILYGVE
KDDPYIIGVNVAAIALTMTVLIMKLRYESHKMRV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 9 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: A0A0T5ZCX2_inward.pdb Alignment file: A0A0T5ZCX2_inw.pir Procheck score ⇒ Ramachandran plot: 91.8% favored 7.5% allowed .7% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0T5ZCX2_outward.pdb Alignment file: A0A0T5ZCX2_out.pir Procheck score ⇒ Ramachandran plot: 93.3% favored 6.7% allowed .0% week .0% disallowed Occluded: Model structure: A0A0T5ZCX2_occluded.pdb Alignment file: A0A0T5ZCX2_occ.pir Procheck score ⇒ Ramachandran plot: 94.8% favored 5.2% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA