Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0S7HCB2

dbSWEET id: dbswt_1081

Accession:   A0A0S7HCB2

Uniprot status:   Unreviewed

Organism:   Poeciliopsis prolifica

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Craniata ⇒ Vertebrata ⇒ Euteleostomi ⇒ Actinopterygii ⇒ Neopterygii ⇒ Teleostei ⇒ Neoteleostei ⇒ Acanthomorphata ⇒ Ovalentaria ⇒ Atherinomorphae ⇒ Cyprinodontiformes ⇒ Poeciliidae ⇒ Poeciliinae ⇒ Poeciliopsis.

Sequence Information back to top


Sequence length:   219

Substrate Binding Site:   NNWN           CVV:   451       CHI:   -11.4

Selectivity Filter:   MNMT           CVV:   437       CHI:   -0.4

Fasta sequence:

>tr|A0A0S7HCB2|A0A0S7HCB2_9TELE|Unreviewed|Poeciliopsis_prolifica|219
MDLTQLLSWACIVFTVGMFSTGLTDLKKMRESKSADNIQFLPFLTTCLNNLGWLFYGTLK
RDPTIVVVNIIGALLQILYIVMYLLYTKQKRLVVLQTLAAAAVLVCGWLYFTTILTEGKA
RLNQLGLTCSVVTVSMYLSPLTDLVAIIRSGDVQVLSFPLTVATFFTSTAWVLYGLQLND
YYIMVPNTPGIFTSLIRFYLFRKFASTSQGSPSYKPLHI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   206

Alignment file: A0A0S7HCB2.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0S7HCB2_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.5% favored    5.4% allowed    2.2% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0S7HCB2_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.5% favored    5.9% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0S7HCB2_occluded.pdb

Procheck score ⇒ Ramachandran plot: 90.9% favored    9.1% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur