Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0S3RFF4

dbSWEET id: dbswt_178

Accession:   A0A0S3RFF4

Uniprot status:   Unreviewed

Organism:   Vigna angularis

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Vigna.

Sequence Information back to top


Sequence length:   328

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   VSVN           CVV:   379       CHI:   4.1

Fasta sequence:

>tr|A0A0S3RFF4|A0A0S3RFF4_PHAAN|Unreviewed|Vigna_angularis|328
MRLLLLLFSHYKYLLILPLTTRAIEREKEITSTEASHFQNRIYPFLHHSVSDREELLDST
HDTKMAINHETWAFVFGLLGNVISFMVFLAPLPTFYQIYKKKTAEGFQSLPYVVALFSSM
LWIYYALVKKDASLLLITINSFGCVIESIYLLIFLVYAPSKTRLSTIKLLLLLNVFGFGA
MLLSTLYFTKGSKRLSVIGWICLVFNISVFAAPLCILKRVIQTKSVEFMPFSLSFFLTVN
AVMWFFYGLLLKDYYIALPNTLGFVFGIIQMVLYLVYRNAKPKTLEEPTKLQELNGHIVD
VVKLGTMTPSEPNHVTKSGAVTETASNV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   66     Model end:   279

Alignment file: A0A0S3RFF4.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0S3RFF4_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.3% favored    4.7% allowed    1.0% week    1.0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0S3RFF4_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.2% favored    7.3% allowed    1.0% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0S3RFF4_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.7% favored    5.7% allowed    .5% week    1.0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur