Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0S3QY01

dbSWEET id: dbswt_408

Accession:   A0A0S3QY01

Uniprot status:   Unreviewed

Organism:   Vigna angularis

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Phaseoleae ⇒ Vigna.

Sequence Information back to top


Sequence length:   290

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   CTVS           CVV:   357       CHI:   5.2

Fasta sequence:

>tr|A0A0S3QY01|A0A0S3QY01_PHAAN|Unreviewed|Vigna_angularis|290
MANDAPYVFAVGIMGNLVSFCCFLAPVPTFYRVCKKKTTEGFQSLPYVAALFTSMLWIFY
AYIKTGEILLITINAFGCFIETVYLVIYITYCPRKARFFTFKMIFLFNVGVIFLVVLLTH
VLAKERTARIELLGWICVVLSTSVFAAPLSIIKVVIRTKSVEFMPITLSLLLTVSAIMWL
AYGILLRDIYVTLPNFVGITFGTIQIVLYFIYRKHTPGKDQKLPEQKDNATNEENGNTAV
SSENHAANSGGFVDIEIGEKKEGKKVEEAQKKQDQTENKTREGSSQLQHN

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   214

Alignment file: A0A0S3QY01.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0S3QY01_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.8% favored    4.1% allowed    1.0% week    1.0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0S3QY01_outward.pdb

Procheck score ⇒ Ramachandran plot: 90.2% favored    7.8% allowed    1.6% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0S3QY01_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.2% favored    5.2% allowed    3.1% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur