Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0S2KJ48
dbSWEET id: dbswt_1992
Accession: A0A0S2KJ48
Uniprot status: Unreviewed
Organism: Prevotella enoeca
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Prevotellaceae ⇒ Prevotella.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: FNFN CVV: 462 CHI: -1.4
Fasta sequence:
>tr|A0A0S2KJ48|A0A0S2KJ48_9BACT|Unreviewed|Prevotella enoeca|86
MDKSKFFERVGWVGMVTSILMYVFYFRVIQQNLSGHPGDPLQPLMAGINCTLWVCYGLFK
EKRDWPITIANAPGVIFGFIAAYTSF
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 11 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: A0A0S2KJ48_inward.pdb Alignment file: A0A0S2KJ48_inw.pir Procheck score ⇒ Ramachandran plot: 91.9% favored 4.8% allowed 2.4% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0S2KJ48_outward.pdb Alignment file: A0A0S2KJ48_out.pir Procheck score ⇒ Ramachandran plot: 87.9% favored 10.5% allowed .8% week .8% disallowed Occluded: Model structure: A0A0S2KJ48_occluded.pdb Alignment file: A0A0S2KJ48_occ.pir Procheck score ⇒ Ramachandran plot: 91.1% favored 8.1% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA