Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0R3RQA5

dbSWEET id: dbswt_1080

Accession:   A0A0R3RQA5

Uniprot status:   Unreviewed

Organism:   Elaeophora elaphi

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Spirurida ⇒ Filarioidea ⇒ Onchocercidae ⇒ Elaeophora.

Sequence Information back to top


Sequence length:   283

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   LGNV           CVV:   373       CHI:   4.1

Fasta sequence:

>tr|A0A0R3RQA5|A0A0R3RQA5_9BILA|Unreviewed|Elaeophora_elaphi|283
MFTEFFRNLTLLKCLSVSAFITTVSLFFCGIPICVNIWKRRSTKDISAVPFLMGVLGAVY
WLRYGLMKMDYTMIAVNVFAAILMGIYLIFYYFMTKKKLWISIEVCAVIFLISLMLLLVQ
IFGHDIFHPLGFTCMTFNILNFGAPLAGLKVVLRQRNCETLPLPMCIANLLVSSQWALYG
VFVSDVYIITPNAIGMLLAMIQIALFLIFPMKQGRLSPIQRCFNPSCCAAAASSSSSDDN
GSHFQSKLLHYLNPSHSLLQITNRESILDTWQHLSKLLSWLPS

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   211

Alignment file: A0A0R3RQA5.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  A0A0R3RQA5_inward.pdb

Procheck score ⇒ Ramachandran plot: 88.2% favored    8.1% allowed    1.6% week    2.2% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  A0A0R3RQA5_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.0% favored    5.4% allowed    1.6% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  A0A0R3RQA5_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.8% favored    9.1% allowed    1.1% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur