| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0R3PU19
dbSWEET id: dbswt_1077
Accession: A0A0R3PU19
Uniprot status: Unreviewed
Organism: Angiostrongylus costaricensis
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Strongylida ⇒ Metastrongyloidea ⇒ Angiostrongylidae ⇒ Angiostrongylus.
Sequence Information back to top
Sequence length: 220
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LSSV CVV: 375 CHI: 6.4
Fasta sequence:
>tr|A0A0R3PU19|A0A0R3PU19_ANGCS|Unreviewed|Angiostrongylus_costaricensis|220
MTFAGDLLPYLSFSAICSTIGLFLCGVQICSRIRERGGTEGTGSAPFLIAFISCAFWLQY
GVLKQDRVVIFVNVVGLMLQGCYLTYYYWMTRHSKILKKVIICELLAIGLMLYLVNYAGL
KDSGRDTLGVICIILNIASIGAPLFQIGEVIRTKNSETLPLPLCLACFAVSLQWLLYGIL
VNDFVIQVPNYIATFLSIIQLSLFIIYPRRPTFVQMKDSI
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 209
Alignment file: A0A0R3PU19.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0R3PU19_inward.pdb
Procheck score ⇒ Ramachandran plot: 91.8% favored 5.5% allowed 2.7% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0R3PU19_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.5% favored 3.8% allowed 1.6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0R3PU19_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.8% favored 7.7% allowed .5% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA