| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0R3PNZ6
dbSWEET id: dbswt_1076
Accession: A0A0R3PNZ6
Uniprot status: Unreviewed
Organism: Angiostrongylus costaricensis
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Strongylida ⇒ Metastrongyloidea ⇒ Angiostrongylidae ⇒ Angiostrongylus.
Sequence Information back to top
Sequence length: 233
Substrate Binding Site: SQCE CVV: 382 CHI: -5.3
Selectivity Filter: LGVV CVV: 382 CHI: 11.8
Fasta sequence:
>tr|A0A0R3PNZ6|A0A0R3PNZ6_ANGCS|Unreviewed|Angiostrongylus_costaricensis|233
MELSISNLFAMYTSNLLWSLFLTSTALHAVALITSPMQAVLKWYRRQSSDSDTCLPYLCA
VIGSGLWLRYSVFIQDTKLILLQSYAVTMQSFFLFALIFYRSKKRRLIRLVLFIAVFLFI
VFYYIQCMNEDDGKEVIRKSQSRKCLSVRVGSSPLQTTGRIASAAQIAGSLVCPYLIYKA
VTSRCVDFVPLAPVAFTWIMELHAIIYSIGIDDFYMLVRIFFRNIALSILFVD
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 11 Model end: 220
Alignment file: A0A0R3PNZ6.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0R3PNZ6_inward.pdb
Procheck score ⇒ Ramachandran plot: 86.6% favored 10.8% allowed .0% week 2.6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0R3PNZ6_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.2% favored 7.2% allowed 1.5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0R3PNZ6_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.3% favored 6.2% allowed 1.0% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA