Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0R3P9P9
dbSWEET id: dbswt_1075
Accession: A0A0R3P9P9
Uniprot status: Unreviewed
Organism: Angiostrongylus costaricensis
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Strongylida ⇒ Metastrongyloidea ⇒ Angiostrongylidae ⇒ Angiostrongylus.
Sequence Information back to top
Sequence length: 230
Substrate Binding Site: GNWN CVV: 412 CHI: -0.6
Selectivity Filter: LGNV CVV: 373 CHI: 4.1
Fasta sequence:
>tr|A0A0R3P9P9|A0A0R3P9P9_ANGCS|Unreviewed|Angiostrongylus_costaricensis|230
MDLQLILQILSCCAIITTIALFLCGIPICIEIMRRKGTTDISGVPFLMGVLGGSFWLRYG
LLKMDNTMIIVNVVGVTLFSIYCLYYFAYTSPKWRFGVKLLLVASLIGTMIGLVEWRPNM
DYLGLVCMTFNILNFGAPLAGLGVVLRKRCCDTVPLPLCIANLLVSSQWFLYGNIVRDAY
IMVPNGIGMALAVLQLSLFVIFPRRENGKSVVSRMARFFSSPVDVEKGEE
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 204
Alignment file: A0A0R3P9P9.pir
Inward Open:
Template: 5CTG.pdb
Model structure: A0A0R3P9P9_inward.pdb
Procheck score ⇒ Ramachandran plot: 90.9% favored 6.9% allowed 1.1% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: A0A0R3P9P9_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.6% favored 6.3% allowed .6% week .6% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: A0A0R3P9P9_occluded.pdb
Procheck score ⇒ Ramachandran plot: 88.0% favored 6.9% allowed 4.0% week 1.1% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA