| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0R2LM03
dbSWEET id: dbswt_1498
Accession: A0A0R2LM03
Uniprot status: Unreviewed
Organism: Lactobacillus kimchiensis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 92
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0R2LM03|A0A0R2LM03_9LACO|Unreviewed|Lactobacillus kimchiensis|92
MQKVDSTKVERIGTIASVMSVLMYVSYIPQIISNLSGTKGNPIQPLVAFINCTIWTAYGL
LKKEKDWPIIWANIPGIFLGAATFITAIFSFN
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 13 Model end: 89 Inward Open: Template: 4X5M.pdb Model structure: A0A0R2LM03_inward.pdb Alignment file: A0A0R2LM03_inw.pir Procheck score ⇒ Ramachandran plot: 93.0% favored 5.5% allowed 1.6% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0R2LM03_outward.pdb Alignment file: A0A0R2LM03_out.pir Procheck score ⇒ Ramachandran plot: 89.1% favored 7.8% allowed 2.3% week .8% disallowed Occluded: Model structure: A0A0R2LM03_occluded.pdb Alignment file: A0A0R2LM03_occ.pir Procheck score ⇒ Ramachandran plot: 89.8% favored 8.6% allowed 1.6% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA