Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0R2HKM3
dbSWEET id: dbswt_1495
Accession: A0A0R2HKM3
Uniprot status: Unreviewed
Organism: Pediococcus damnosus
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Pediococcus.
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0R2HKM3|A0A0R2HKM3_9LACO|Unreviewed|Pediococcus damnosus|88
MKEESKLIQIIGRIASGLSVLMYVSYIPQIIANLNGNYGNPIQPLVAALNCIVWTIYGYF
KPAKDWPIIIANVPGIFLGIITFCTALH
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 12 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: A0A0R2HKM3_inward.pdb Alignment file: A0A0R2HKM3_inw.pir Procheck score ⇒ Ramachandran plot: 83.9% favored 13.7% allowed .0% week 2.4% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0R2HKM3_outward.pdb Alignment file: A0A0R2HKM3_out.pir Procheck score ⇒ Ramachandran plot: 87.9% favored 7.3% allowed 3.2% week 1.6% disallowed Occluded: Model structure: A0A0R2HKM3_occluded.pdb Alignment file: A0A0R2HKM3_occ.pir Procheck score ⇒ Ramachandran plot: 92.7% favored 6.5% allowed .0% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA