Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0R2GVC4

dbSWEET id: dbswt_2016

Accession:   A0A0R2GVC4

Uniprot status:   Unreviewed

Organism:   Lactobacillus ingluviei

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.

Sequence Information back to top


Sequence length:   89

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|A0A0R2GVC4|A0A0R2GVC4_9LACO|Unreviewed|Lactobacillus ingluviei|89
MMENQEKTFILWLGRIASVIAVLMYVSYIAQIQKNLAGVKAAPLQPFVAGVNCTLWSIYA
FFKRDRDWFVFWANFPGIFFSFATFATCF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   14     Model end:   90

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0R2GVC4_inward.pdb    Alignment file: A0A0R2GVC4_inw.pir

Procheck score ⇒ Ramachandran plot: 89.7% favored    9.6% allowed    .7% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0R2GVC4_outward.pdb    Alignment file: A0A0R2GVC4_out.pir

Procheck score ⇒ Ramachandran plot: 90.4% favored    7.4% allowed    .7% week    1.5% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0R2GVC4_occluded.pdb    Alignment file: A0A0R2GVC4_occ.pir

Procheck score ⇒ Ramachandran plot: 89.0% favored    7.4% allowed    2.9% week    .7% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur