| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : A0A0R2FSH5
dbSWEET id: dbswt_1493
Accession: A0A0R2FSH5
Uniprot status: Unreviewed
Organism: Weissella halotolerans
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Leuconostocaceae ⇒ Weissella.
Sequence Information back to top
Sequence length: 106
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: ANAN CVV: 326 CHI: -3.4
Fasta sequence:
>tr|A0A0R2FSH5|A0A0R2FSH5_9LACT|Unreviewed|Weissella halotolerans| 106
MPLEFDNKDSQKTDKPVPAERINHIKRIGTMATVTCILMYGAYISMIWSNLHGHPVGILQ
PFIAMINASLWTWYGFAKTHPDKPIIISNLPGIVFGLLTVITSLMA
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 29 Model end: 105 Inward Open: Template: 4X5M.pdb Model structure: A0A0R2FSH5_inward.pdb Alignment file: A0A0R2FSH5_inw.pir Procheck score ⇒ Ramachandran plot: 91.3% favored 7.9% allowed .0% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0R2FSH5_outward.pdb Alignment file: A0A0R2FSH5_out.pir Procheck score ⇒ Ramachandran plot: 86.5% favored 12.7% allowed .8% week .0% disallowed Occluded: Model structure: A0A0R2FSH5_occluded.pdb Alignment file: A0A0R2FSH5_occ.pir Procheck score ⇒ Ramachandran plot: 94.4% favored 4.8% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA