Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0R2FG48

dbSWEET id: dbswt_1492

Accession:   A0A0R2FG48

Uniprot status:   Unreviewed

Organism:   Lactobacillus selangorensis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.

Sequence Information back to top


Sequence length:   91

Substrate Binding Site:   SNSN           CVV:   338       CHI:   -8.6

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|A0A0R2FG48|A0A0R2FG48_9LACO|Unreviewed|Lactobacillus selangorensis|91
MKQMEKNKYIQLFSVGRIATLFSILMYVSYIPQIINNLAGVRGNPIQPLCAAINSILWVT
YGAIKPKKDWPVVIANVPGIFLGLAAFLTAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   16     Model end:   92

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0R2FG48_inward.pdb    Alignment file: A0A0R2FG48_inw.pir

Procheck score ⇒ Ramachandran plot: 89.7% favored    8.7% allowed    1.6% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0R2FG48_outward.pdb    Alignment file: A0A0R2FG48_out.pir

Procheck score ⇒ Ramachandran plot: 92.1% favored    6.3% allowed    1.6% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0R2FG48_occluded.pdb    Alignment file: A0A0R2FG48_occ.pir

Procheck score ⇒ Ramachandran plot: 96.0% favored    3.2% allowed    .0% week    .8% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur