Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0R2CM57
dbSWEET id: dbswt_1486
Accession: A0A0R2CM57
Uniprot status: Unreviewed
Organism: Lactobacillus cacaonum
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 104
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0R2CM57|A0A0R2CM57_9LACO|Unreviewed|Lactobacillus cacaonum| 104
MRIDTSKYPEGKDAVSADRIKRLKILSKLATIMCIAMYISYIPQIISNFSGHPVGFLQLF
VAMVNASLWTGYGWNKTYKDWPVIISNVPGIFFCLFTVITIYIH
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 27 Model end: 103 Inward Open: Template: 4X5M.pdb Model structure: A0A0R2CM57_inward.pdb Alignment file: A0A0R2CM57_inw.pir Procheck score ⇒ Ramachandran plot: 93.1% favored 3.1% allowed 2.3% week 1.5% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0R2CM57_outward.pdb Alignment file: A0A0R2CM57_out.pir Procheck score ⇒ Ramachandran plot: 81.5% favored 13.8% allowed 1.5% week 3.1% disallowed Occluded: Model structure: A0A0R2CM57_occluded.pdb Alignment file: A0A0R2CM57_occ.pir Procheck score ⇒ Ramachandran plot: 92.3% favored 4.6% allowed .0% week 3.1% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA