Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0R2C756
dbSWEET id: dbswt_1991
Accession: A0A0R2C756
Uniprot status: Unreviewed
Organism: Lactobacillus thailandensis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 112
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0R2C756|A0A0R2C756_9LACO|Unreviewed|Lactobacillus thailandensis| 112
MLEEADIYMRIDTSKYPEGKDAVNPKRVRRLKILSKVATIMCISMYISYIPEIIANFSGS
PVSPLQPLVAAVNATLWVAYGWTKTYRDWPVIISNLPGIVFGLVTVITVYIH
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 35 Model end: 111 Inward Open: Template: 4X5M.pdb Model structure: A0A0R2C756_inward.pdb Alignment file: A0A0R2C756_inw.pir Procheck score ⇒ Ramachandran plot: 88.3% favored 10.2% allowed .0% week 1.6% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0R2C756_outward.pdb Alignment file: A0A0R2C756_out.pir Procheck score ⇒ Ramachandran plot: 90.6% favored 7.8% allowed .8% week .8% disallowed Occluded: Model structure: A0A0R2C756_occluded.pdb Alignment file: A0A0R2C756_occ.pir Procheck score ⇒ Ramachandran plot: 87.5% favored 9.4% allowed 3.1% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA