Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : A0A0R2C756

dbSWEET id: dbswt_1991

Accession:   A0A0R2C756

Uniprot status:   Unreviewed

Organism:   Lactobacillus thailandensis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.

Sequence Information back to top


Sequence length:   112

Substrate Binding Site:   ANAN           CVV:   326       CHI:   -3.4

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|A0A0R2C756|A0A0R2C756_9LACO|Unreviewed|Lactobacillus thailandensis| 112
MLEEADIYMRIDTSKYPEGKDAVNPKRVRRLKILSKVATIMCISMYISYIPEIIANFSGS
PVSPLQPLVAAVNATLWVAYGWTKTYRDWPVIISNLPGIVFGLVTVITVYIH

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   35     Model end:   111

Inward Open:

Template:   4X5M.pdb

Model structure:  A0A0R2C756_inward.pdb    Alignment file: A0A0R2C756_inw.pir

Procheck score ⇒ Ramachandran plot: 88.3% favored    10.2% allowed    .0% week    1.6% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  A0A0R2C756_outward.pdb    Alignment file: A0A0R2C756_out.pir

Procheck score ⇒ Ramachandran plot: 90.6% favored    7.8% allowed    .8% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  A0A0R2C756_occluded.pdb    Alignment file: A0A0R2C756_occ.pir

Procheck score ⇒ Ramachandran plot: 87.5% favored    9.4% allowed    3.1% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur