Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0R2AY64
dbSWEET id: dbswt_1485
Accession: A0A0R2AY64
Uniprot status: Unreviewed
Organism: Lactobacillus brantae
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 95
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0R2AY64|A0A0R2AY64_9LACO|Unreviewed|Lactobacillus brantae|95
MISEVKQMNEESKTVQILGRVSSIMSILMYVSYIPQIMSNLNGQYGNPIQPLVAMINCIF
WTCYGILKKERDWPIIFANVPGIFLGAITFFTALH
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 19 Model end: 95 Inward Open: Template: 4X5M.pdb Model structure: A0A0R2AY64_inward.pdb Alignment file: A0A0R2AY64_inw.pir Procheck score ⇒ Ramachandran plot: 85.9% favored 9.4% allowed 3.1% week 1.6% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0R2AY64_outward.pdb Alignment file: A0A0R2AY64_out.pir Procheck score ⇒ Ramachandran plot: 92.2% favored 5.5% allowed 1.6% week .8% disallowed Occluded: Model structure: A0A0R2AY64_occluded.pdb Alignment file: A0A0R2AY64_occ.pir Procheck score ⇒ Ramachandran plot: 94.5% favored 4.7% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA