Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : A0A0R2A6N8
dbSWEET id: dbswt_2015
Accession: A0A0R2A6N8
Uniprot status: Unreviewed
Organism: Lactobacillus vaccinostercus
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 90
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|A0A0R2A6N8|A0A0R2A6N8_9LACO|Unreviewed|Lactobacillus vaccinostercus|90
MNNDVKMVKFVSIIGKLASIVSIMMYVSYVLQIVDNLNGSKGNPIQPLVASINCMLWVSY
ALIKRQKDWPVAIANIPGIFLGFTTFITGL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 15 Model end: 91 Inward Open: Template: 4X5M.pdb Model structure: A0A0R2A6N8_inward.pdb Alignment file: A0A0R2A6N8_inw.pir Procheck score ⇒ Ramachandran plot: 93.1% favored 6.9% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: A0A0R2A6N8_outward.pdb Alignment file: A0A0R2A6N8_out.pir Procheck score ⇒ Ramachandran plot: 94.6% favored 5.4% allowed .0% week .0% disallowed Occluded: Model structure: A0A0R2A6N8_occluded.pdb Alignment file: A0A0R2A6N8_occ.pir Procheck score ⇒ Ramachandran plot: 92.3% favored 5.4% allowed 2.3% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA